Teriparatide
Parathyroid hormone (1-34) fragment
An FDA-approved anabolic bone-building agent.
Half-life
~ 1 hour (subcutaneous)
Mol. weight
4117.8 g/mol
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRRKLLQDAH
Discussions
0 threads
Overview
Teriparatide is the recombinant N-terminal (1-34) fragment of human parathyroid hormone (PTH) and an FDA-approved anabolic agent for osteoporosis. Unlike antiresorptive drugs that slow bone loss, teriparatide actively stimulates osteoblasts to build new bone when administered intermittently, and is also studied for fracture healing.
Mechanism of action
Teriparatide mimics the N-terminal active fragment of parathyroid hormone. When given intermittently (rather than continuously), it stimulates osteoblast activity and net new bone formation, increasing bone mineral density and reducing fracture risk — an anabolic rather than antiresorptive mechanism.
Researched benefits
- Increases bone mineral density (clinically approved)
- Reduces vertebral and non-vertebral fracture risk
- Anabolic: actively builds new bone rather than slowing loss
- Studied for fracture healing acceleration
Considerations
- Prescription medication requiring medical supervision and monitoring
- Long-term (lifetime) use is limited by safety guidance
- Associated with potential hypercalcemia and requires monitoring
- Not a self-research compound
Key Academic Literature & Studies
Search more in PubMedPeer-reviewed citations and clinical trials evaluating Teriparatide in scientific literature.
Query PubMed for recent peer-reviewed preclinical and clinical publications on Teriparatide:
View Teriparatide index on PubMed (NCBI)