Library
Immune

LL-37

Human cathelicidin antimicrobial peptide (hCAP-18 active form)

The body's antimicrobial peptide.

Half-life

~ short (protease-sensitive in vivo)

Mol. weight

4493.3 g/mol

Sequence

[LL-37, 37 aa]

Discussions

0 threads

Overview

The active C-terminal fragment of human cathelicidin (hCAP-18), an antimicrobial peptide that directly kills bacteria, fungi, and viruses by disrupting their membranes and simultaneously modulates immune and inflammatory responses. It is a key effector of innate immunity — the body's chemical first line of defense that acts before adaptive antibodies form.

Mechanism of action

LL-37 is a cationic amphipathic peptide that physically disrupts microbial membranes through electrostatic binding and pore formation, killing bacteria, fungi, and enveloped viruses directly. Beyond direct killing, it acts as an immune modulator: it recruits immune cells (chemotaxis), regulates inflammatory signaling, and promotes wound healing and angiogenesis. This dual role — direct antimicrobial plus immunomodulatory — is characteristic of the cathelicidin family and is why LL-37 is studied well beyond simple infection control.

Researched benefits

  • Direct broad-spectrum antimicrobial activity
  • Immune modulation and immune-cell recruitment
  • Studied for wound healing and tissue repair

Considerations

  • Research stage for exogenous use
  • Can have pro-inflammatory effects in some contexts
  • Professional guidance advised

Key Academic Literature & Studies

Search more in PubMed

Peer-reviewed citations and clinical trials evaluating LL-37 in scientific literature.

Query PubMed for recent peer-reviewed preclinical and clinical publications on LL-37:

View LL-37 index on PubMed (NCBI)

Articles & logs