Library
Hormone

ACTH 1-39

Adrenocorticotropic hormone (full)

The adrenal stimulator.

Half-life

~ minutes

Mol. weight

4541.1 g/mol

Sequence

SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

Discussions

0 threads

Overview

The full-length adrenocorticotropic hormone (39 amino acids) that stimulates the adrenal cortex to synthesize and release cortisol and other corticosteroids. It sits at the center of the HPA (hypothalamic-pituitary-adrenal) stress axis and is used clinically to test adrenal responsiveness, with ACTH(4-7) being the fragment retained in cognitive peptides like Semax after stripping the adrenal-signaling portion.

Mechanism of action

ACTH 1-39 binds melanocortin-2 receptors (MC2R) on cells of the adrenal cortex, triggering the synthesis and release of cortisol, the body's primary glucocorticoid stress hormone, along with other corticosteroids. It is released by the pituitary in response to CRH from the hypothalamus — the final step of the HPA axis. Its potency in elevating cortisol is exactly why it's used diagnostically to confirm adrenal responsiveness and why it's treated cautiously in research contexts.

Researched benefits

  • Stimulates natural cortisol production
  • Used clinically to test adrenal responsiveness
  • Central to stress-axis physiology research

Considerations

  • Potent cortisol elevation with broad endocrine effects
  • ACTH(4-7) cognitive fragment separated from adrenal signaling in Semax
  • Strictly clinical/research context

Key Academic Literature & Studies

Search more in PubMed

Peer-reviewed citations and clinical trials evaluating ACTH 1-39 in scientific literature.

Query PubMed for recent peer-reviewed preclinical and clinical publications on ACTH 1-39:

View ACTH 1-39 index on PubMed (NCBI)

Articles & logs